PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG106900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 88aa    MW: 9843.4 Da    PI: 10.7381
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG106900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.73.6e-29959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien++nrqvtfskRr+g++KKA EL +LCda+v v++fss g+lye+s+
  Pavir.4KG106900.2.p  9 KRIENETNRQVTFSKRRAGLFKKARELAILCDAQVGVLVFSSAGRLYEFSN 59
                         79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.885161IPR002100Transcription factor, MADS-box
SMARTSM004329.1E-38160IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.14E-31378IPR002100Transcription factor, MADS-box
CDDcd002659.80E-41375No hitNo description
PfamPF003191.5E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MVRGKTVIKR IENETNRQVT FSKRRAGLFK KARELAILCD AQVGVLVFSS AGRLYEFSNT  60
SMTSIVERYQ HMKEGNQLMS ASTEAKV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-19177177Myocyte-specific enhancer factor 2B
1tqe_Q2e-19177177Myocyte-specific enhancer factor 2B
1tqe_R2e-19177177Myocyte-specific enhancer factor 2B
1tqe_S2e-19177177Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641670.19e-46PREDICTED: MADS-box transcription factor 23-like
RefseqXP_015641671.19e-46PREDICTED: MADS-box transcription factor 23-like
SwissprotQ6VAM48e-38MAD23_ORYSJ; MADS-box transcription factor 23
TrEMBLA0A0E0LBE35e-46A0A0E0LBE3_ORYPU; Uncharacterized protein
TrEMBLA0A0P0WWA79e-47A0A0P0WWA7_ORYSJ; Os06g0347700 protein
STRINGBGIOSGA026939-PA1e-36(Oryza sativa Indica Group)
STRINGORGLA08G0137000.17e-36(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.13e-34AGAMOUS-like 44